Lineage for d1fz0b_ (1fz0 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2557Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 2566Protein Methane monooxygenase hydrolase, beta and alpha subunits [47254] (2 species)
  7. 2567Species Methylococcus capsulatus [TaxId:414] [47255] (10 PDB entries)
  8. 2577Domain d1fz0b_: 1fz0 B: [16757]
    Other proteins in same PDB: d1fz0e_, d1fz0f_

Details for d1fz0b_

PDB Entry: 1fz0 (more details), 2.07 Å

PDB Description: methane monooxygenase hydroxylase, form ii mixed-valent grown anaerobically
PDB Compounds: (B:)

SCOP Domain Sequences for d1fz0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz0b_ a.25.1.2 (B:) Methane monooxygenase hydrolase, beta and alpha subunits {Methylococcus capsulatus}
nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde
rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng
ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd
avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs
iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi
wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany
pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl
rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli
aqphvrgdklwtlddikrlncvfknpvkafn

SCOP Domain Coordinates for d1fz0b_:

Click to download the PDB-style file with coordinates for d1fz0b_.
(The format of our PDB-style files is described here.)

Timeline for d1fz0b_: