SCOPe 2.05: Domain d2qeta_: 2qet A:

Lineage for d2qeta_ (2qet A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Phytolacca dioica [TaxId:29725] [188356] (6 PDB entries)

8. Domain d2qeta_: 2qet A: [167566]
   automated match to d1gika_
   complexed with ade; mutant

Details for d2qeta_

PDB Entry: 2qet, 1.24 Å

PDB Description: structure of the mutant s211a of the ribosome inactivating protein pdl4 from p. dioica in complex with adenine

PDB Compounds: (A:) Ribosome-inactivating protein PD-L4

SCOPe Domain Sequences for d2qeta_:

Sequence; same for both SEQRES and ATOM records:

>d2qeta_ d.165.1.1 (A:) automated matches {Phytolacca dioica [TaxId: 29725]}
vntitfdvgnatinkyatfmeslrneakdptlkcygipmlpdsnltpkyvlvklqdassk
titlmlrrnnlyvmgysdlyngkcryhifndisstestdventlcpnsnsrekkainyns
qystlqnkagvssrsqvqlgiqilnsdigkisgvstftdkteaefllvaiqmvseaarfk
yienqvktnfnrafnpnpkvlsleenwgkialaihnakngaltsplelknaddtkwivlr
vdeikpdmgllnyvsgtcqtt

Timeline for d2qeta_:

• d2qeta_ first appeared in SCOPe 2.01
  
• d2qeta_ appears in SCOPe 2.04
  
• d2qeta_ appears in SCOPe 2.06
  
• d2qeta_ appears in the current release, SCOPe 2.08