Lineage for d2qe0d_ (2qe0 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515970Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2515971Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2515972Family c.82.1.1: ALDH-like [53721] (6 proteins)
  6. 2516294Protein automated matches [190401] (5 species)
    not a true protein
  7. 2516372Species Streptococcus mutans [TaxId:1309] [187673] (3 PDB entries)
  8. 2516380Domain d2qe0d_: 2qe0 D: [167554]
    automated match to d1euha_
    protein/RNA complex; complexed with g3h, nap

Details for d2qe0d_

PDB Entry: 2qe0 (more details), 2.19 Å

PDB Description: thioacylenzyme intermediate of gapn from s. mutans, new data integration and refinement.
PDB Compounds: (D:) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2qe0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qe0d_ c.82.1.1 (D:) automated matches {Streptococcus mutans [TaxId: 1309]}
tkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsy
ieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmege
vleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptq
gsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigkm
agmrpimlalggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadelv
ekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicp
ilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgia
eqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik

SCOPe Domain Coordinates for d2qe0d_:

Click to download the PDB-style file with coordinates for d2qe0d_.
(The format of our PDB-style files is described here.)

Timeline for d2qe0d_: