SCOPe 2.06: Domain d2qdwa_: 2qdw A:

Lineage for d2qdwa_ (2qdw A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Amicyanin [49505] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
   Uniprot P22364

8. Domain d2qdwa_: 2qdw A: [167550]
   automated match to d1aaca_
   complexed with cu1, po4; mutant

Details for d2qdwa_

PDB Entry: 2qdw, 0.92 Å

PDB Description: structure of cu(i) form of the m51a mutant of amicyanin

PDB Compounds: (A:) amicyanin

SCOPe Domain Sequences for d2qdwa_:

Sequence; same for both SEQRES and ATOM records:

>d2qdwa_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreaaphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

Timeline for d2qdwa_:

• d2qdwa_ first appeared in SCOPe 2.01
  
• d2qdwa_ appears in SCOPe 2.05
  
• d2qdwa_ appears in SCOPe 2.07
  
• d2qdwa_ appears in the current release, SCOPe 2.08