SCOPe 2.01: Domain d2qdpa_: 2qdp A:

Lineage for d2qdpa_ (2qdp A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (19 PDB entries)

8. Domain d2qdpa_: 2qdp A: [167548]
   automated match to d1jlna_
   complexed with po4; mutant

Details for d2qdpa_

PDB Entry: 2qdp, 2.72 Å

PDB Description: crystal structure of the heptp catalytic domain c270s mutant crystallized in ammonium acetate

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 7

SCOPe Domain Sequences for d2qdpa_:

Sequence; same for both SEQRES and ATOM records:

>d2qdpa_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntprevtlhflrtaghpltrwalqrqppspkqleeeflkipsnfvspedldipghaskdr
yktilpnpqsrvclgraqsqedgdyinanyirgydgkekvyiatqgpmpntvsdfwemvw
qeevslivmltqlregkekcvhywpteeetygpfqiriqdmkecpeytvrqltiqyqeer
rsvkhilfsawpdhqtpesagpllrlvaeveespetaahpgpivvhssagigrtgcfiat
rigcqqlkargevdilgivcqlrldrggmiqtaeqyqflhhtlalyagqlpe

Timeline for d2qdpa_:

• d2qdpa_ is new in SCOPe 2.01-stable
  
• d2qdpa_ appears in SCOPe 2.02
  
• d2qdpa_ appears in the current release, SCOPe 2.08