| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
| Protein Uridine phosphorylase [53176] (2 species) |
| Species Salmonella typhimurium [TaxId:90371] [117656] (23 PDB entries) Uniprot P0A1F6 |
| Domain d2qdka_: 2qdk A: [167541] automated match to d1ryza_ |
PDB Entry: 2qdk (more details), 1.62 Å
SCOPe Domain Sequences for d2qdka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qdka_ c.56.2.1 (A:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgka
vivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgasl
hfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfk
gsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesha
vkivveaarrll
Timeline for d2qdka_: