Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
Protein Odorant binding protein LUSH [101190] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries) |
Domain d2qdib_: 2qdi B: [167540] automated match to d1ooha_ complexed with pge; mutant |
PDB Entry: 2qdi (more details), 2 Å
SCOPe Domain Sequences for d2qdib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qdib_ a.39.2.1 (B:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenaagq fmwp
Timeline for d2qdib_: