SCOPe 2.05: Domain d2qdib_: 2qdi B:

Lineage for d2qdib_ (2qdi B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Odorant binding protein LUSH [101190] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)

8. Domain d2qdib_: 2qdi B: [167540]
   automated match to d1ooha_
   complexed with pge; mutant

Details for d2qdib_

PDB Entry: 2qdi, 2 Å

PDB Description: drosophila obp lush d118a mutation

PDB Compounds: (B:) General odorant-binding protein lush

SCOPe Domain Sequences for d2qdib_:

Sequence; same for both SEQRES and ATOM records:

>d2qdib_ a.39.2.1 (B:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenaagq
fmwp

Timeline for d2qdib_:

• d2qdib_ first appeared in SCOPe 2.01
  
• d2qdib_ appears in SCOPe 2.04
  
• d2qdib_ appears in SCOPe 2.06
  
• d2qdib_ appears in the current release, SCOPe 2.08