SCOPe 2.08: Domain d2qd6b_: 2qd6 B:

Lineage for d2qd6b_ (2qd6 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (32 PDB entries)

8. Domain d2qd6b_: 2qd6 B: [167536]
   automated match to d1fgcc_
   complexed with 065, act, cl, na; mutant

Details for d2qd6b_

PDB Entry: 2qd6, 1.28 Å

PDB Description: hiv-1 protease mutant i50v with potent antiviral inhibitor grl-98065

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d2qd6b_:

Sequence; same for both SEQRES and ATOM records:

>d2qd6b_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d2qd6b_:

• d2qd6b_ first appeared in SCOPe 2.01
  
• d2qd6b_ appears in SCOPe 2.07