SCOPe 2.01: Domain d2qd5a_: 2qd5 A:

Lineage for d2qd5a_ (2qd5 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.1: Chelatase [53800] (4 families)
   interdomain linker is short; swapping of C-terminal helices between the two domains

5. Family c.92.1.1: Ferrochelatase [53801] (2 proteins)

6. Protein Ferrochelatase [53802] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64189] (14 PDB entries)

8. Domain d2qd5a_: 2qd5 A: [167533]
   automated match to d1hrka_
   complexed with acy, chd, fes, gol, oxy, pb, pp9

Details for d2qd5a_

PDB Entry: 2qd5, 2.3 Å

PDB Description: Structure of wild type human ferrochelatase in complex with a lead-porphyrin compound

PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d2qd5a_:

Sequence; same for both SEQRES and ATOM records:

>d2qd5a_ c.92.1.1 (A:) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrrtpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

Timeline for d2qd5a_:

• d2qd5a_ is new in SCOPe 2.01-stable
  
• d2qd5a_ appears in SCOPe 2.02
  
• d2qd5a_ appears in the current release, SCOPe 2.08