![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.1: Chelatase [53800] (4 families) ![]() interdomain linker is short; swapping of C-terminal helices between the two domains |
![]() | Family c.92.1.1: Ferrochelatase [53801] (2 proteins) automatically mapped to Pfam PF00762 |
![]() | Protein automated matches [190319] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187137] (2 PDB entries) |
![]() | Domain d2qd2a_: 2qd2 A: [167527] automated match to d1hrka_ complexed with bct, chd, fes, hem, imd |
PDB Entry: 2qd2 (more details), 2.2 Å
SCOPe Domain Sequences for d2qd2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qd2a_ c.92.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapaiakrrtpkiqeqyr rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql
Timeline for d2qd2a_: