Lineage for d2qd2a_ (2qd2 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008088Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1008089Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 1008090Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
  6. 1008146Protein automated matches [190319] (2 species)
    not a true protein
  7. 1008150Species Human (Homo sapiens) [TaxId:9606] [187137] (2 PDB entries)
  8. 1008153Domain d2qd2a_: 2qd2 A: [167527]
    automated match to d1hrka_
    complexed with bct, chd, fes, hem, imd

Details for d2qd2a_

PDB Entry: 2qd2 (more details), 2.2 Å

PDB Description: f110a variant of human ferrochelatase with protoheme bound
PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d2qd2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qd2a_ c.92.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapaiakrrtpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

SCOPe Domain Coordinates for d2qd2a_:

Click to download the PDB-style file with coordinates for d2qd2a_.
(The format of our PDB-style files is described here.)

Timeline for d2qd2a_: