Lineage for d2qd1b_ (2qd1 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008088Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1008089Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 1008090Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
  6. 1008091Protein Ferrochelatase [53802] (3 species)
  7. 1008113Species Human (Homo sapiens) [TaxId:9606] [64189] (14 PDB entries)
  8. 1008135Domain d2qd1b_: 2qd1 B: [167524]
    automated match to d1hrka_
    complexed with chd, fes, imd, pp9

Details for d2qd1b_

PDB Entry: 2qd1 (more details), 2.2 Å

PDB Description: 2.2 angstrom structure of the human ferrochelatase variant e343k with substrate bound
PDB Compounds: (B:) Ferrochelatase

SCOPe Domain Sequences for d2qd1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qd1b_ c.92.1.1 (B:) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrrtpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhiktlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

SCOPe Domain Coordinates for d2qd1b_:

Click to download the PDB-style file with coordinates for d2qd1b_.
(The format of our PDB-style files is described here.)

Timeline for d2qd1b_: