Class b: All beta proteins [48724] (174 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (7 species) not a true protein |
Species Arthrobacter sp. [TaxId:290399] [187341] (1 PDB entry) |
Domain d2qcka_: 2qck A: [167519] automated match to d1rz0a_ complexed with po4 |
PDB Entry: 2qck (more details), 1.9 Å
SCOPe Domain Sequences for d2qcka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qcka_ b.45.1.0 (A:) automated matches {Arthrobacter sp. [TaxId: 290399]} fegtfkemfrrhaagvaiitvnyngtpygftatsvaslsaqpprftfnmarsssswpaia ntthigvhmlgldnqeladrfartknrfegdhwelgpyevpilkdvagwligkiqmrlsf ennavvvvevvegqvgedgtpllyhsgaysqpvpldyei
Timeline for d2qcka_: