Lineage for d2qcka_ (2qck A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952712Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 952713Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 952888Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 952889Protein automated matches [190439] (7 species)
    not a true protein
  7. 952892Species Arthrobacter sp. [TaxId:290399] [187341] (1 PDB entry)
  8. 952893Domain d2qcka_: 2qck A: [167519]
    automated match to d1rz0a_
    complexed with po4

Details for d2qcka_

PDB Entry: 2qck (more details), 1.9 Å

PDB Description: crystal structure of flavin reductase domain protein (yp_831077.1) from arthrobacter sp. fb24 at 1.90 a resolution
PDB Compounds: (A:) Flavin reductase domain protein

SCOPe Domain Sequences for d2qcka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qcka_ b.45.1.0 (A:) automated matches {Arthrobacter sp. [TaxId: 290399]}
fegtfkemfrrhaagvaiitvnyngtpygftatsvaslsaqpprftfnmarsssswpaia
ntthigvhmlgldnqeladrfartknrfegdhwelgpyevpilkdvagwligkiqmrlsf
ennavvvvevvegqvgedgtpllyhsgaysqpvpldyei

SCOPe Domain Coordinates for d2qcka_:

Click to download the PDB-style file with coordinates for d2qcka_.
(The format of our PDB-style files is described here.)

Timeline for d2qcka_: