Lineage for d2qc9a_ (2qc9 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685730Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1685731Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1685732Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
  6. 1685821Protein automated matches [190101] (6 species)
    not a true protein
  7. 1685860Species Mouse (Mus musculus) [TaxId:10090] [187645] (3 PDB entries)
  8. 1685861Domain d2qc9a_: 2qc9 A: [167517]
    automated match to d1ot8a_

Details for d2qc9a_

PDB Entry: 2qc9 (more details), 2.35 Å

PDB Description: Mouse Notch 1 Ankyrin Repeat Intracellular Domain
PDB Compounds: (A:) Notch 1 protein

SCOPe Domain Sequences for d2qc9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qc9a_ d.211.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqillrn
ratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnnvda
avvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdiaqe
rmhhdivrlldey

SCOPe Domain Coordinates for d2qc9a_:

Click to download the PDB-style file with coordinates for d2qc9a_.
(The format of our PDB-style files is described here.)

Timeline for d2qc9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qc9b_