SCOPe 2.01: Domain d2qc9a_: 2qc9 A:

Lineage for d2qc9a_ (2qc9 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187645] (2 PDB entries)

8. Domain d2qc9a_: 2qc9 A: [167517]
   automated match to d1ot8a_

Details for d2qc9a_

PDB Entry: 2qc9, 2.35 Å

PDB Description: Mouse Notch 1 Ankyrin Repeat Intracellular Domain

PDB Compounds: (A:) Notch 1 protein

SCOPe Domain Sequences for d2qc9a_:

Sequence; same for both SEQRES and ATOM records:

>d2qc9a_ d.211.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqillrn
ratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnnvda
avvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdiaqe
rmhhdivrlldey

Timeline for d2qc9a_:

• d2qc9a_ is new in SCOPe 2.01-stable
  
• d2qc9a_ appears in SCOPe 2.02
  
• d2qc9a_ appears in the current release, SCOPe 2.08