SCOPe 2.08: Domain d2qc2b_: 2qc2 B:

Lineage for d2qc2b_ (2qc2 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (86 PDB entries)

8. Domain d2qc2b_: 2qc2 B: [167516]
   Other proteins in same PDB: d2qc2a2
   automated match to d1uj1b_
   mutant
   has additional subdomain(s) that are not in the common domain

Details for d2qc2b_

PDB Entry: 2qc2, 2.7 Å

PDB Description: crystal structure of severe acute respiratory syndrome (sars) 3c-like protease asn214ala mutant

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d2qc2b_:

Sequence; same for both SEQRES and ATOM records:

>d2qc2b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaaviagdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtf

Timeline for d2qc2b_:

• d2qc2b_ first appeared in SCOPe 2.01
  
• d2qc2b_ appears in SCOPe 2.07