Lineage for d2qb1b_ (2qb1 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090417Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1090418Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1090419Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 1090429Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)
  7. 1090430Species Escherichia coli [TaxId:562] [158525] (3 PDB entries)
  8. 1090438Domain d2qb1b_: 2qb1 B: [167504]
    automated match to d1lkyb_

Details for d2qb1b_

PDB Entry: 2qb1 (more details), 2.61 Å

PDB Description: 2tel crystallization module
PDB Compounds: (B:) E80-TELSAM domain

SCOPe Domain Sequences for d2qb1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qb1b_ a.60.1.1 (B:) Etv6 transcription factor pointed domain (Tel SAM) {Escherichia coli [TaxId: 562]}
sialpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdvlyellqhilaqa

SCOPe Domain Coordinates for d2qb1b_:

Click to download the PDB-style file with coordinates for d2qb1b_.
(The format of our PDB-style files is described here.)

Timeline for d2qb1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qb1a_