![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.1: Pointed domain [47770] (7 proteins) |
![]() | Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [158525] (3 PDB entries) |
![]() | Domain d2qare_: 2qar E: [167500] Other proteins in same PDB: d2qarc_, d2qarf_ automated match to d1ji7c_ complexed with nh4, no3 |
PDB Entry: 2qar (more details), 2.4 Å
SCOPe Domain Sequences for d2qare_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qare_ a.60.1.1 (E:) Etv6 transcription factor pointed domain (Tel SAM) {Escherichia coli [TaxId: 562]} sirlpahlrlqpiywsrddvaqwlkwaenefslspidsntfemngkalllltkedfryrs phsgdvlyellqhilkqrdleaeaaaaeaaaka
Timeline for d2qare_: