Lineage for d2qarb_ (2qar B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2324210Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2324211Family a.60.1.1: Pointed domain [47770] (7 protein domains)
  6. 2324222Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)
  7. 2324223Species Escherichia coli [TaxId:562] [158525] (3 PDB entries)
  8. 2324225Domain d2qarb_: 2qar B: [167497]
    Other proteins in same PDB: d2qarc_, d2qarf_
    automated match to d1ji7c_
    complexed with nh4, no3

Details for d2qarb_

PDB Entry: 2qar (more details), 2.4 Å

PDB Description: structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.
PDB Compounds: (B:) TELSAM domain

SCOPe Domain Sequences for d2qarb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qarb_ a.60.1.1 (B:) Etv6 transcription factor pointed domain (Tel SAM) {Escherichia coli [TaxId: 562]}
sirlpahlrlqpiywsrddvaqwlkwaenefslspidsntfemngkalllltkedfryrs
phsgdvlyellqhilkqrdleaeaaaaeaaaka

SCOPe Domain Coordinates for d2qarb_:

Click to download the PDB-style file with coordinates for d2qarb_.
(The format of our PDB-style files is described here.)

Timeline for d2qarb_: