Lineage for d2qabb_ (2qab B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728396Protein Estrogen receptor alpha [48519] (1 species)
  7. 2728397Species Human (Homo sapiens) [TaxId:9606] [48520] (107 PDB entries)
    Uniprot P03372 307-551
  8. 2728507Domain d2qabb_: 2qab B: [167493]
    automated match to d1qkua_
    complexed with ei1; mutant

Details for d2qabb_

PDB Entry: 2qab (more details), 1.89 Å

PDB Description: crystal structure of estrogen receptor alpha ligand binding domain mutant 537s complexed with an ethyl indazole compound
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d2qabb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qabb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdllleml
dahrl

SCOPe Domain Coordinates for d2qabb_:

Click to download the PDB-style file with coordinates for d2qabb_.
(The format of our PDB-style files is described here.)

Timeline for d2qabb_: