Lineage for d2qa6b_ (2qa6 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008578Protein Estrogen receptor alpha [48519] (1 species)
  7. 2008579Species Human (Homo sapiens) [TaxId:9606] [48520] (64 PDB entries)
    Uniprot P03372 307-551
  8. 2008663Domain d2qa6b_: 2qa6 B: [167489]
    automated match to d1qkua_
    complexed with kn2; mutant

Details for d2qa6b_

PDB Entry: 2qa6 (more details), 2.6 Å

PDB Description: crystal structure of estrogen receptor alpha mutant 537s complexed with 4-(6-hydroxy-1h-indazol-3-yl)benzene-1,3-diol
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d2qa6b_:

Sequence, based on SEQRES records: (download)

>d2qa6b_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemld
ahrlh

Sequence, based on observed residues (ATOM records): (download)

>d2qa6b_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlih
lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr
lh

SCOPe Domain Coordinates for d2qa6b_:

Click to download the PDB-style file with coordinates for d2qa6b_.
(The format of our PDB-style files is described here.)

Timeline for d2qa6b_: