Lineage for d2q9ta_ (2q9t A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1186012Protein Phosphate-binding protein [53860] (4 species)
  7. 1186033Species Pseudomonas fluorescens [TaxId:294] [189065] (4 PDB entries)
  8. 1186037Domain d2q9ta_: 2q9t A: [167484]
    automated match to d2v3qa1
    complexed with act, edo, gol, po4, so4

Details for d2q9ta_

PDB Entry: 2q9t (more details), 1.43 Å

PDB Description: High-resolution structure of the DING protein from Pseudomonas fluorescens
PDB Compounds: (A:) ding

SCOPe Domain Sequences for d2q9ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q9ta_ c.94.1.1 (A:) Phosphate-binding protein {Pseudomonas fluorescens [TaxId: 294]}
mdingggatlpqalyqtsgvltagfaqyigvgsgngkaaflnndytkfqagvtnknvhwa
gsdsklsatelstyasakqptwgkliqvpsvgtsvaipfnksgsaavdlsvqelcgvfsg
rintwdgisgsgrtgpivvvyrsessgttelftrflnakcnaetgnfavtttfgtsfsgg
lpagavaatgsqgvmtalaagdgritymspdfaaptlaglddatkvarvgknvatntqgv
spaaanvsaaigavpvpaaadrsnpdawvpvfgpdntagvqpyptsgypilgftnlifsq
cyadatqttqvrdfftkhygasnnndaaitanafvplptawkatvrasfltasnalsign
tnvcngigrplleh

SCOPe Domain Coordinates for d2q9ta_:

Click to download the PDB-style file with coordinates for d2q9ta_.
(The format of our PDB-style files is described here.)

Timeline for d2q9ta_: