SCOPe 2.06: Domain d2q8xb_: 2q8x B:

Lineage for d2q8xb_ (2q8x B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Xylanase [51488] (6 species)

7. Species Bacillus stearothermophilus, Ixt6 [TaxId:1422] [102063] (7 PDB entries)
   intra-cellular xylanase

8. Domain d2q8xb_: 2q8x B: [167482]
   automated match to d1n82a_
   complexed with gol, na

Details for d2q8xb_

PDB Entry: 2q8x, 1.45 Å

PDB Description: the high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from g. stearothermophilus

PDB Compounds: (B:) intra-cellular xylanase

SCOPe Domain Sequences for d2q8xb_:

Sequence; same for both SEQRES and ATOM records:

>d2q8xb_ c.1.8.3 (B:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]}
slpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftfqe
adrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrryk
gkiycwdvineavadegnellrpskwrqiigddfmeqaflyayeadpdallfyndynecf
pekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhiteld
vsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwldnf
pvhgrknwpllfdeqhkpkpafwravsv

Timeline for d2q8xb_:

• d2q8xb_ first appeared in SCOPe 2.01
  
• d2q8xb_ appears in SCOPe 2.05
  
• d2q8xb_ appears in SCOPe 2.07
  
• d2q8xb_ appears in the current release, SCOPe 2.08