Lineage for d2q8xa_ (2q8x A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339836Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1340267Protein Xylanase [51488] (6 species)
  7. 1340268Species Bacillus stearothermophilus, Ixt6 [TaxId:1422] [102063] (7 PDB entries)
    intra-cellular xylanase
  8. 1340269Domain d2q8xa_: 2q8x A: [167481]
    automated match to d1n82a_
    complexed with gol, na

Details for d2q8xa_

PDB Entry: 2q8x (more details), 1.45 Å

PDB Description: the high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from g. stearothermophilus
PDB Compounds: (A:) intra-cellular xylanase

SCOPe Domain Sequences for d2q8xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q8xa_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]}
nsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftf
qeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrr
ykgkiycwdvineavadegnellrpskwrqiigddfmeqaflyayeadpdallfyndyne
cfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhite
ldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwld
nfpvhgrknwpllfdeqhkpkpafwravsv

SCOPe Domain Coordinates for d2q8xa_:

Click to download the PDB-style file with coordinates for d2q8xa_.
(The format of our PDB-style files is described here.)

Timeline for d2q8xa_: