![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.0: automated matches [191483] (1 protein) not a true family |
![]() | Protein automated matches [190775] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188003] (12 PDB entries) |
![]() | Domain d2q8rf_: 2q8r F: [167473] automated match to d1b50a_ |
PDB Entry: 2q8r (more details), 1.82 Å
SCOPe Domain Sequences for d2q8rf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q8rf_ d.9.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gpyhpseccftyttykiprqrimdyyetnsqcskpgivfitkrghsvctnpsdkwvqdyi kdm
Timeline for d2q8rf_: