Lineage for d2q8re_ (2q8r E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2929386Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2929387Protein automated matches [190775] (3 species)
    not a true protein
  7. 2929388Species Human (Homo sapiens) [TaxId:9606] [188003] (12 PDB entries)
  8. 2929392Domain d2q8re_: 2q8r E: [167472]
    automated match to d1b50a_

Details for d2q8re_

PDB Entry: 2q8r (more details), 1.82 Å

PDB Description: structural and functional characterization of cc chemokine ccl14
PDB Compounds: (E:) ccl14

SCOPe Domain Sequences for d2q8re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q8re_ d.9.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpyhpseccftyttykiprqrimdyyetnsqcskpgivfitkrghsvctnpsdkwvqdyi
kdmken

SCOPe Domain Coordinates for d2q8re_:

Click to download the PDB-style file with coordinates for d2q8re_.
(The format of our PDB-style files is described here.)

Timeline for d2q8re_: