Lineage for d2q6fb_ (2q6f B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058295Species Infectious bronchitis virus [TaxId:11120] [188342] (2 PDB entries)
  8. 2058300Domain d2q6fb_: 2q6f B: [167454]
    automated match to d1lvod_

Details for d2q6fb_

PDB Entry: 2q6f (more details), 2 Å

PDB Description: crystal structure of infectious bronchitis virus (ibv) main protease in complex with a michael acceptor inhibitor n3
PDB Compounds: (B:) Infectious bronchitis virus (IBV) main protease

SCOPe Domain Sequences for d2q6fb_:

Sequence, based on SEQRES records: (download)

>d2q6fb_ b.47.1.0 (B:) automated matches {Infectious bronchitis virus [TaxId: 11120]}
sgfkklvspssavekcivsvsyrgnnlnglwlgdsiycprhvlgkfsgdqwgdvlnlann
hefevvtqngvtlnvvsrrlkgavlilqtavanaetpkykfvkancgdsftiacsyggtv
iglypvtmrsngtirasflagacgsvgfniekgvvnffymhhlelpnalhtgtdlmgefy
ggyvdeevaqrvppdnlvtnnivawlyaaiisvkessfsqpkwlesttvsiedynrwasd
ngftpfststaitklsaitgvdvckllrtimvksaqwgsdpilgqynfedeltpesvfnq
vg

Sequence, based on observed residues (ATOM records): (download)

>d2q6fb_ b.47.1.0 (B:) automated matches {Infectious bronchitis virus [TaxId: 11120]}
sgfkklvspssavekcivsvsyrgnnlnglwlgdsiycprhvlgkfsgdqwgdvlnlann
hefevvtqngvtlnvvsrrlkgavlilqtavanaetpkykfvkancgdsftiacsyggtv
iglypvtmrsngtirasflagacgsvgfniekgvvnffymhhlelpnalhtgtdlmgefy
ggyvdeevaqrvppdnlvtnnivawlyaaiisvpkwlesttvsiedynrwasdngftpfs
tstaitklsaitgvdvckllrtimvksaqwgsdpilgqynfedeltpesvfnqvg

SCOPe Domain Coordinates for d2q6fb_:

Click to download the PDB-style file with coordinates for d2q6fb_.
(The format of our PDB-style files is described here.)

Timeline for d2q6fb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2q6fa_