Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Infectious bronchitis virus [TaxId:11120] [188342] (2 PDB entries) |
Domain d2q6fb_: 2q6f B: [167454] automated match to d1lvod_ |
PDB Entry: 2q6f (more details), 2 Å
SCOPe Domain Sequences for d2q6fb_:
Sequence, based on SEQRES records: (download)
>d2q6fb_ b.47.1.0 (B:) automated matches {Infectious bronchitis virus [TaxId: 11120]} sgfkklvspssavekcivsvsyrgnnlnglwlgdsiycprhvlgkfsgdqwgdvlnlann hefevvtqngvtlnvvsrrlkgavlilqtavanaetpkykfvkancgdsftiacsyggtv iglypvtmrsngtirasflagacgsvgfniekgvvnffymhhlelpnalhtgtdlmgefy ggyvdeevaqrvppdnlvtnnivawlyaaiisvkessfsqpkwlesttvsiedynrwasd ngftpfststaitklsaitgvdvckllrtimvksaqwgsdpilgqynfedeltpesvfnq vg
>d2q6fb_ b.47.1.0 (B:) automated matches {Infectious bronchitis virus [TaxId: 11120]} sgfkklvspssavekcivsvsyrgnnlnglwlgdsiycprhvlgkfsgdqwgdvlnlann hefevvtqngvtlnvvsrrlkgavlilqtavanaetpkykfvkancgdsftiacsyggtv iglypvtmrsngtirasflagacgsvgfniekgvvnffymhhlelpnalhtgtdlmgefy ggyvdeevaqrvppdnlvtnnivawlyaaiisvpkwlesttvsiedynrwasdngftpfs tstaitklsaitgvdvckllrtimvksaqwgsdpilgqynfedeltpesvfnqvg
Timeline for d2q6fb_: