Lineage for d2q6db1 (2q6d B:1-306)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798451Species Infectious bronchitis virus [TaxId:11120] [188342] (2 PDB entries)
  8. 2798453Domain d2q6db1: 2q6d B:1-306 [167448]
    Other proteins in same PDB: d2q6db2
    automated match to d1lvod_

Details for d2q6db1

PDB Entry: 2q6d (more details), 2.35 Å

PDB Description: Crystal structure of infectious bronchitis virus (IBV) main protease
PDB Compounds: (B:) Infectious bronchitis virus (IBV) main protease

SCOPe Domain Sequences for d2q6db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q6db1 b.47.1.0 (B:1-306) automated matches {Infectious bronchitis virus [TaxId: 11120]}
sgfkklvspssavekcivsvsyrgnnlnglwlgdsiycprhvlgkfsgdqwgdvlnlann
hefevvtqngvtlnvvsrrlkgavlilqtavanaetpkykfvkancgdsftiacsyggtv
iglypvtmrsngtirasflagacgsvgfniekgvvnffymhhlelpnalhtgtdlmgefy
ggyvdeevaqrvppdnlvtnnivawlyaaiisvkessfsqpkwlesttvsiedynrwasd
ngftpfststaitklsaitgvdvckllrtimvksaqwgsdpilgqynfedeltpesvfnq
vggvrl

SCOPe Domain Coordinates for d2q6db1:

Click to download the PDB-style file with coordinates for d2q6db1.
(The format of our PDB-style files is described here.)

Timeline for d2q6db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q6db2