Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Infectious bronchitis virus [TaxId:11120] [188342] (2 PDB entries) |
Domain d2q6db1: 2q6d B:1-306 [167448] Other proteins in same PDB: d2q6db2 automated match to d1lvod_ |
PDB Entry: 2q6d (more details), 2.35 Å
SCOPe Domain Sequences for d2q6db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q6db1 b.47.1.0 (B:1-306) automated matches {Infectious bronchitis virus [TaxId: 11120]} sgfkklvspssavekcivsvsyrgnnlnglwlgdsiycprhvlgkfsgdqwgdvlnlann hefevvtqngvtlnvvsrrlkgavlilqtavanaetpkykfvkancgdsftiacsyggtv iglypvtmrsngtirasflagacgsvgfniekgvvnffymhhlelpnalhtgtdlmgefy ggyvdeevaqrvppdnlvtnnivawlyaaiisvkessfsqpkwlesttvsiedynrwasd ngftpfststaitklsaitgvdvckllrtimvksaqwgsdpilgqynfedeltpesvfnq vggvrl
Timeline for d2q6db1: