Lineage for d2q62c_ (2q62 C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587666Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
    Pfam PF03358
  6. 1587690Protein automated matches [190892] (2 species)
    not a true protein
  7. 1587712Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [188302] (1 PDB entry)
  8. 1587715Domain d2q62c_: 2q62 C: [167437]
    automated match to d2fzva1
    complexed with so4

Details for d2q62c_

PDB Entry: 2q62 (more details), 1.8 Å

PDB Description: Crystal Structure of ArsH from Sinorhizobium meliloti
PDB Compounds: (C:) arsH

SCOPe Domain Sequences for d2q62c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q62c_ c.23.5.4 (C:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
dlpaanlqqlrlpdsaslrpafsthrprililygslrtvsysrllaeearrlleffgaev
kvfdpsglplpdaapvshpkvqelrelsiwsegqvwvsperhgamtgimkaqidwiplst
gsirptqgktlavmqvsggsqsfnavnqmrilgrwmrmitipnqssvakafqefdangrm
kpssyydrvvdvmeelvkftlltrdcsayltdryserkesa

SCOPe Domain Coordinates for d2q62c_:

Click to download the PDB-style file with coordinates for d2q62c_.
(The format of our PDB-style files is described here.)

Timeline for d2q62c_: