| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
| Family a.204.1.0: automated matches [191410] (1 protein) not a true family |
| Protein automated matches [190562] (4 species) not a true protein |
| Species Vibrio sp. [TaxId:344879] [188224] (3 PDB entries) |
| Domain d2q5zb_: 2q5z B: [167434] Other proteins in same PDB: d2q5za2 automated match to d1vmga_ complexed with gol, mg |
PDB Entry: 2q5z (more details), 2.3 Å
SCOPe Domain Sequences for d2q5zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q5zb_ a.204.1.0 (B:) automated matches {Vibrio sp. [TaxId: 344879]}
mklselqshikefdyapeqsehyffklieevgelsesirkgksgqptldelkgsvaeely
dvlyyvcalanihgvnlektrelkevlnkvkynr
Timeline for d2q5zb_: