SCOPe 2.08: Domain d2q5za1: 2q5z A:1-92

Lineage for d2q5za1 (2q5z A:1-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.0: automated matches [191410] (1 protein)
   not a true family

6. Protein automated matches [190562] (4 species)
   not a true protein

7. Species Vibrio sp. [TaxId:344879] [188224] (3 PDB entries)

8. Domain d2q5za1: 2q5z A:1-92 [167433]
   Other proteins in same PDB: d2q5za2
   automated match to d1vmga_
   complexed with gol, mg

Details for d2q5za1

PDB Entry: 2q5z, 2.3 Å

PDB Description: crystal structure of imazg from vibrio dat 722: ntag-imazg (p43212)

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2q5za1:

Sequence; same for both SEQRES and ATOM records:

>d2q5za1 a.204.1.0 (A:1-92) automated matches {Vibrio sp. [TaxId: 344879]}
mklselqshikefdyapeqsehyffklieevgelsesirkgksgqptldelkgsvaeely
dvlyyvcalanihgvnlektrelkevlnkvky

Timeline for d2q5za1:

• d2q5za1 first appeared in SCOPe 2.01, called d2q5za_
  
• d2q5za1 appears in SCOPe 2.07