![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
![]() | Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
![]() | Family a.204.1.0: automated matches [191410] (1 protein) not a true family |
![]() | Protein automated matches [190562] (4 species) not a true protein |
![]() | Species Vibrio sp. [TaxId:344879] [188224] (3 PDB entries) |
![]() | Domain d2q5za1: 2q5z A:1-92 [167433] Other proteins in same PDB: d2q5za2 automated match to d1vmga_ complexed with gol, mg |
PDB Entry: 2q5z (more details), 2.3 Å
SCOPe Domain Sequences for d2q5za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q5za1 a.204.1.0 (A:1-92) automated matches {Vibrio sp. [TaxId: 344879]} mklselqshikefdyapeqsehyffklieevgelsesirkgksgqptldelkgsvaeely dvlyyvcalanihgvnlektrelkevlnkvky
Timeline for d2q5za1: