SCOPe 2.05: Domain d2q5ka_: 2q5k A:

Lineage for d2q5ka_ (2q5k A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d2q5ka_: 2q5k A: [167431]
   automated match to d1kzka_
   complexed with ab1, po4

Details for d2q5ka_

PDB Entry: 2q5k, 1.95 Å

PDB Description: crystal structure of lopinavir bound to wild type hiv-1 protease

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d2q5ka_:

Sequence; same for both SEQRES and ATOM records:

>d2q5ka_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d2q5ka_:

• d2q5ka_ first appeared in SCOPe 2.01
  
• d2q5ka_ appears in SCOPe 2.04
  
• d2q5ka_ appears in SCOPe 2.06
  
• d2q5ka_ appears in the current release, SCOPe 2.08