![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.16: NLI interacting factor-like phosphatase [110509] (2 proteins) Pfam PF03031; NIF; the insertion subdomain is a 3-stranded beta-sheet; |
![]() | Protein automated matches [190659] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187808] (8 PDB entries) |
![]() | Domain d2q5ea_: 2q5e A: [167423] automated match to d1ta0a_ complexed with mg |
PDB Entry: 2q5e (more details), 2.51 Å
SCOPe Domain Sequences for d2q5ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q5ea_ c.108.1.16 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} llpevteedqgricvvidldetlvhssfkpinnadfivpieiegtthqvyvlkrpyvdef lrrmgelfecvlftaslakyadpvtdlldrcgvfrarlfrescvfhqgcyvkdlsrlgrd lrktlildnspasyifhpenavpvqswfddmadtellnlipifeelsgaedvytslgqlr a
Timeline for d2q5ea_: