Lineage for d2q54a_ (2q54 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1320915Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1320931Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1321128Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (421 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 1321443Domain d2q54a_: 2q54 A: [167418]
    automated match to d1kzka_
    complexed with act, mu1, po4

Details for d2q54a_

PDB Entry: 2q54 (more details), 1.85 Å

PDB Description: crystal structure of kb73 bound to hiv-1 protease
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d2q54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q54a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d2q54a_:

Click to download the PDB-style file with coordinates for d2q54a_.
(The format of our PDB-style files is described here.)

Timeline for d2q54a_: