SCOPe 2.05: Domain d2q51a_: 2q51 A:

Lineage for d2q51a_ (2q51 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.7: AstE/AspA-like [142526] (3 proteins)
   Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229)

6. Protein Aspartoacylase AspA [159649] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159651] (5 PDB entries)
   Uniprot P45381 9-310

8. Domain d2q51a_: 2q51 A: [167416]
   automated match to d2i3ca1
   complexed with po4, zn

Details for d2q51a_

PDB Entry: 2q51, 2.8 Å

PDB Description: Ensemble refinement of the protein crystal structure of an aspartoacylase from Homo sapiens

PDB Compounds: (A:) Aspartoacylase

SCOPe Domain Sequences for d2q51a_:

Sequence; same for both SEQRES and ATOM records:

>d2q51a_ c.56.5.7 (A:) Aspartoacylase AspA {Human (Homo sapiens) [TaxId: 9606]}
ehiqkvaifggthgneltgvflvkhwlengaeiqrtglevkpfitnpravkkctryidcd
lnrifdlenlgkkmsedlpyevrraqeinhlfgpkdsedsydiifdlhnttsnmgctlil
edsrnnfliqmfhyiktslaplpcyvyliehpslkyattrsiakypvgievgpqpqgvlr
adildqmrkmikhaldfihhfnegkefppcaievykiiekvdyprdengeiaaiihpnlq
dqdwkplhpgdpmfltldgktiplggdctvypvfvneaayyekkeafakttkltlnaksi
rc

Timeline for d2q51a_:

• d2q51a_ first appeared in SCOPe 2.01
  
• d2q51a_ appears in SCOPe 2.04
  
• d2q51a_ appears in SCOPe 2.06
  
• d2q51a_ appears in the current release, SCOPe 2.08