Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.7: AstE/AspA-like [142526] (3 proteins) Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229) |
Protein Aspartoacylase AspA [159649] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [159651] (5 PDB entries) Uniprot P45381 9-310 |
Domain d2q51a_: 2q51 A: [167416] automated match to d2i3ca1 complexed with po4, zn |
PDB Entry: 2q51 (more details), 2.8 Å
SCOPe Domain Sequences for d2q51a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q51a_ c.56.5.7 (A:) Aspartoacylase AspA {Human (Homo sapiens) [TaxId: 9606]} ehiqkvaifggthgneltgvflvkhwlengaeiqrtglevkpfitnpravkkctryidcd lnrifdlenlgkkmsedlpyevrraqeinhlfgpkdsedsydiifdlhnttsnmgctlil edsrnnfliqmfhyiktslaplpcyvyliehpslkyattrsiakypvgievgpqpqgvlr adildqmrkmikhaldfihhfnegkefppcaievykiiekvdyprdengeiaaiihpnlq dqdwkplhpgdpmfltldgktiplggdctvypvfvneaayyekkeafakttkltlnaksi rc
Timeline for d2q51a_: