SCOPe 2.01: Domain d2q4zb_: 2q4z B:

Lineage for d2q4zb_ (2q4z B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.7: AstE/AspA-like [142526] (3 proteins)
   Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229)

6. Protein automated matches [190870] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188219] (1 PDB entry)

8. Domain d2q4zb_: 2q4z B: [167415]
   automated match to d2gu2a1
   complexed with so4, zn

Details for d2q4zb_

PDB Entry: 2q4z, 1.8 Å

PDB Description: ensemble refinement of the protein crystal structure of an aspartoacylase from rattus norvegicus

PDB Compounds: (B:) Aspartoacylase

SCOPe Domain Sequences for d2q4zb_:

Sequence; same for both SEQRES and ATOM records:

>d2q4zb_ c.56.5.7 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cvaeepikkiaifggthgneltgvflvthwlkngaevhraglevkpfitnpravekctry
idcdlnrvfdlenlskemsedlpyevrraqeinhlfgpknsddaydvvfdlhnttsnmgc
tlilgdsgndfliqmfhyiktcmaplpcsvyliehpslkyattrsiakypvgievgpqph
gvlradildqmrrmlkhaldfiqrfnegkefppcaidvykimekvdyprnesgdvaavih
pnlqdqdwkplhpgdpvfvsldgkviplggdctvypvfvneaayyekkeafakttkltln
aksirst

Timeline for d2q4zb_:

• d2q4zb_ is new in SCOPe 2.01-stable
  
• d2q4zb_ appears in SCOPe 2.02
  
• d2q4zb_ appears in the current release, SCOPe 2.08