Lineage for d2q4ya_ (2q4y A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968505Protein Hypothetical protein AT1g77540 [118064] (1 species)
  7. 2968506Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118065] (6 PDB entries)
    Uniprot Q8LEN2
  8. 2968510Domain d2q4ya_: 2q4y A: [167413]
    automated match to d2evna1
    complexed with coa
    missing some secondary structures that made up less than one-third of the common domain

Details for d2q4ya_

PDB Entry: 2q4y (more details), 2.06 Å

PDB Description: Ensemble refinement of the protein crystal structure of At1g77540-coenzyme A complex
PDB Compounds: (A:) Uncharacterized protein At1g77540

SCOPe Domain Sequences for d2q4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4ya_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
asshsisiipscsyvsdtflprnpswkplih

SCOPe Domain Coordinates for d2q4ya_:

Click to download the PDB-style file with coordinates for d2q4ya_.
(The format of our PDB-style files is described here.)

Timeline for d2q4ya_: