Lineage for d2q3ja_ (2q3j A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008088Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1008089Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 1008090Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
  6. 1008091Protein Ferrochelatase [53802] (3 species)
  7. 1008092Species Bacillus subtilis [TaxId:1423] [53803] (15 PDB entries)
  8. 1008103Domain d2q3ja_: 2q3j A: [167408]
    automated match to d1doza_
    complexed with h02, mg

Details for d2q3ja_

PDB Entry: 2q3j (more details), 2.39 Å

PDB Description: crystal structure of the his183ala variant of bacillus subtilis ferrochelatase in complex with n-methyl mesoporphyrin
PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d2q3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3ja_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis [TaxId: 1423]}
kmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteqqa
hnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsvqs
ynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsaas
lpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdlfe
qkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalatvv
lkklgr

SCOPe Domain Coordinates for d2q3ja_:

Click to download the PDB-style file with coordinates for d2q3ja_.
(The format of our PDB-style files is described here.)

Timeline for d2q3ja_: