SCOPe 2.06: Domain d2q3gb1: 2q3g B:1-84

Lineage for d2q3gb1 (2q3g B:1-84)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)

8. Domain d2q3gb1: 2q3g B:1-84 [167407]
   Other proteins in same PDB: d2q3ga2, d2q3ga3, d2q3gb2
   automated match to d1rgwa_
   complexed with cl, edo

Details for d2q3gb1

PDB Entry: 2q3g, 1.11 Å

PDB Description: structure of the pdz domain of human pdlim7 bound to a c-terminal extension from human beta-tropomyosin

PDB Compounds: (B:) PDZ and LIM domain protein 7

SCOPe Domain Sequences for d2q3gb1:

Sequence; same for both SEQRES and ATOM records:

>d2q3gb1 b.36.1.0 (B:1-84) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdsfkvvlegpapwgfrlqggkdfnvplsisrltpggkaaqagvavgdwvlsidgenags
lthieaqnkiracgerlslglsra

Timeline for d2q3gb1:

• d2q3gb1 first appeared in SCOPe 2.01, called d2q3gb_
  
• d2q3gb1 was called d2q3gb_ in SCOPe 2.05
  
• d2q3gb1 appears in SCOPe 2.07
  
• d2q3gb1 appears in the current release, SCOPe 2.08