Lineage for d2q3gb_ (2q3g B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948106Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 948107Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 948564Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 948565Protein automated matches [190436] (3 species)
    not a true protein
  7. 948566Species Human (Homo sapiens) [TaxId:9606] [187333] (15 PDB entries)
  8. 948568Domain d2q3gb_: 2q3g B: [167407]
    automated match to d1rgwa_
    complexed with cl, edo

Details for d2q3gb_

PDB Entry: 2q3g (more details), 1.11 Å

PDB Description: structure of the pdz domain of human pdlim7 bound to a c-terminal extension from human beta-tropomyosin
PDB Compounds: (B:) PDZ and LIM domain protein 7

SCOPe Domain Sequences for d2q3gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3gb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdsfkvvlegpapwgfrlqggkdfnvplsisrltpggkaaqagvavgdwvlsidgenags
lthieaqnkiracgerlslglsraitsl

SCOPe Domain Coordinates for d2q3gb_:

Click to download the PDB-style file with coordinates for d2q3gb_.
(The format of our PDB-style files is described here.)

Timeline for d2q3gb_: