Lineage for d2q3ab_ (2q3a B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744174Species Macaca mulatta [TaxId:9541] [188468] (1 PDB entry)
  8. 2744176Domain d2q3ab_: 2q3a B: [167405]
    automated match to d1akjd_

Details for d2q3ab_

PDB Entry: 2q3a (more details), 2.2 Å

PDB Description: Crystal Structure of Rhesus Macaque CD8 Alpha-Alpha Homodimer
PDB Compounds: (B:) cd8

SCOPe Domain Sequences for d2q3ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3ab_ b.1.1.1 (B:) automated matches {Macaca mulatta [TaxId: 9541]}
nqfrvsplgrtwnlgetvelkcqvllsnptsgcswlfqprgtaarptfllylsqnkpkaa
egldtqrfsgkrlgdtfvltlrdfrqenegyyfcsalsnsimyfshfvpvflpa

SCOPe Domain Coordinates for d2q3ab_:

Click to download the PDB-style file with coordinates for d2q3ab_.
(The format of our PDB-style files is described here.)

Timeline for d2q3ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2q3aa_