| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Macaca mulatta [TaxId:9541] [188468] (1 PDB entry) |
| Domain d2q3aa_: 2q3a A: [167404] automated match to d1akjd_ |
PDB Entry: 2q3a (more details), 2.2 Å
SCOPe Domain Sequences for d2q3aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3aa_ b.1.1.1 (A:) automated matches {Macaca mulatta [TaxId: 9541]}
nqfrvsplgrtwnlgetvelkcqvllsnptsgcswlfqprgtaarptfllylsqnkpkaa
egldtqrfsgkrlgdtfvltlrdfrqenegyyfcsalsnsimyfshfvpvflpakpt
Timeline for d2q3aa_: