Lineage for d2q2oa_ (2q2o A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912238Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2912239Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
    automatically mapped to Pfam PF00762
  6. 2912240Protein Ferrochelatase [53802] (3 species)
  7. 2912241Species Bacillus subtilis [TaxId:1423] [53803] (16 PDB entries)
  8. 2912252Domain d2q2oa_: 2q2o A: [167401]
    automated match to d1doza_
    complexed with h01, mg

Details for d2q2oa_

PDB Entry: 2q2o (more details), 2.1 Å

PDB Description: crystal structure of h183c bacillus subtilis ferrochelatase in complex with deuteroporphyrin ix 2,4-disulfonic acid dihydrochloride
PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d2q2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2oa_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis [TaxId: 1423]}
kkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteqq
ahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsvq
synkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsac
slpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdlf
eqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalatv
vlkklgr

SCOPe Domain Coordinates for d2q2oa_:

Click to download the PDB-style file with coordinates for d2q2oa_.
(The format of our PDB-style files is described here.)

Timeline for d2q2oa_: