| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein Snake phospholipase A2 [48624] (38 species) |
| Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (3 PDB entries) |
| Domain d2q2jb_: 2q2j B: [167398] automated match to d1qlla_ complexed with so4, trs |
PDB Entry: 2q2j (more details), 1.65 Å
SCOPe Domain Sequences for d2q2jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q2jb_ a.133.1.2 (B:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadd
c
Timeline for d2q2jb_: