Lineage for d2q2jb_ (2q2j B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015739Protein Snake phospholipase A2 [48624] (38 species)
  7. 2015778Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (3 PDB entries)
  8. 2015780Domain d2q2jb_: 2q2j B: [167398]
    automated match to d1qlla_
    complexed with so4, trs

Details for d2q2jb_

PDB Entry: 2q2j (more details), 1.65 Å

PDB Description: Crystal structure of PrTX-I, a PLA2 homolog from Bothrops pirajai
PDB Compounds: (B:) Phospholipase A2 homolog 1

SCOPe Domain Sequences for d2q2jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2jb_ a.133.1.2 (B:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadd
c

SCOPe Domain Coordinates for d2q2jb_:

Click to download the PDB-style file with coordinates for d2q2jb_.
(The format of our PDB-style files is described here.)

Timeline for d2q2jb_: