SCOPe 2.01: Domain d2q20b_: 2q20 B:

Lineage for d2q20b_ (2q20 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (24 PDB entries)

8. Domain d2q20b_: 2q20 B: [167394]
   automated match to d1igml_

Details for d2q20b_

PDB Entry: 2q20, 1.3 Å

PDB Description: structure of the germline vk1 o18/o8 light chain variable domain homodimer

PDB Compounds: (B:) Vk1 O18/O8 germline light chain variable domain

SCOPe Domain Sequences for d2q20b_:

Sequence; same for both SEQRES and ATOM records:

>d2q20b_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
psrfsgsgsgtdftftisslqpediatyycqqydnlpytfgqgtkleik

Timeline for d2q20b_:

• d2q20b_ is new in SCOPe 2.01-stable
  
• d2q20b_ appears in SCOPe 2.02
  
• d2q20b_ appears in the current release, SCOPe 2.08