Lineage for d2q20a_ (2q20 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742241Domain d2q20a_: 2q20 A: [167393]
    automated match to d1igml_

Details for d2q20a_

PDB Entry: 2q20 (more details), 1.3 Å

PDB Description: structure of the germline vk1 o18/o8 light chain variable domain homodimer
PDB Compounds: (A:) Vk1 O18/O8 germline light chain variable domain

SCOPe Domain Sequences for d2q20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q20a_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvp
srfsgsgsgtdftftisslqpediatyycqqydnlpytfgqgtkleik

SCOPe Domain Coordinates for d2q20a_:

Click to download the PDB-style file with coordinates for d2q20a_.
(The format of our PDB-style files is described here.)

Timeline for d2q20a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2q20b_