Lineage for d2q1eb_ (2q1e B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2019694Species Human (Homo sapiens) [TaxId:9606] [188740] (180 PDB entries)
  8. 2019807Domain d2q1eb_: 2q1e B: [167390]
    automated match to d1b0wa_
    complexed with so4

Details for d2q1eb_

PDB Entry: 2q1e (more details), 2.55 Å

PDB Description: altered dimer interface decreases stability in an amyloidogenic kappa1 bence jones protein.
PDB Compounds: (B:) Amyloidogenic immunoglobulin light chain protein AL-09

SCOPe Domain Sequences for d2q1eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q1eb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik

SCOPe Domain Coordinates for d2q1eb_:

Click to download the PDB-style file with coordinates for d2q1eb_.
(The format of our PDB-style files is described here.)

Timeline for d2q1eb_: