Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
Protein automated matches [190120] (6 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [187332] (2 PDB entries) |
Domain d2q0va_: 2q0v A: [167384] automated match to d1jatb_ complexed with po4 |
PDB Entry: 2q0v (more details), 2.4 Å
SCOPe Domain Sequences for d2q0va_:
Sequence, based on SEQRES records: (download)
>d2q0va_ d.20.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} nlyfqgivprsfrlldelergqkgnvsegvsfglesadditlsnwsctifgqpgtvfenr iysltifcddnypdspptvkfdtkiemscvdncgrviknnlhilknwnrnytietilisl rqemlssankrlpqpnegevy
>d2q0va_ d.20.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} nlyfqgivprsfrlldelergqkgvsegvsfglesadditlsnwsctifgqpgtvfenri ysltifcddnypdspptvkfdtkiemscvdncgrviknnlhilknwnrnytietilislr qemlssankrlpqpnegevy
Timeline for d2q0va_: