Lineage for d1qghk_ (1qgh K:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46714Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 46791Protein Dodecameric ferritin homolog DPS [47250] (2 species)
  7. 46805Species Listeria innocua [TaxId:1642] [47252] (1 PDB entry)
  8. 46816Domain d1qghk_: 1qgh K: [16738]

Details for d1qghk_

PDB Entry: 1qgh (more details), 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.

SCOP Domain Sequences for d1qghk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qghk_ a.25.1.1 (K:) Dodecameric ferritin homolog DPS {Listeria innocua}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOP Domain Coordinates for d1qghk_:

Click to download the PDB-style file with coordinates for d1qghk_.
(The format of our PDB-style files is described here.)

Timeline for d1qghk_: