Lineage for d1qghk_ (1qgh K:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701933Species Listeria innocua [TaxId:1642] [47252] (7 PDB entries)
  8. 2701944Domain d1qghk_: 1qgh K: [16738]
    complexed with fe

Details for d1qghk_

PDB Entry: 1qgh (more details), 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.
PDB Compounds: (K:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d1qghk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qghk_ a.25.1.1 (K:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d1qghk_:

Click to download the PDB-style file with coordinates for d1qghk_.
(The format of our PDB-style files is described here.)

Timeline for d1qghk_: